Recombinant Human Contactin-associated protein-like 2 (CNTNAP2), partial

Recombinant Human Contactin-associated protein-like 2 (CNTNAP2), partial
SKU
CSB-EP887030HU-100
Packaging Unit
100 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Neuroscience

Uniprot: Q9UHC6

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-tagged

Purity: Greater than 95% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 20.5 kDa

Gene Names: CNTNAP2

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 35-181aa

Protein Length: Partial

Target Protein Sequence: CDEPLVSGLPHVAFSSSSSISGSYSPGYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPGNINSDGVVRHELQHPIIARYVRIVPLDWNGEGRIGLRIEVYGC

Endotoxin: Not test.

Relevance: Required for gap junction formation (Probable). Required, with CNTNAP1, for radial and longitudinal organization of myelinated axons. Plays a role in the formation of functional distinct domains critical for saltatory conduction of nerve impulses in myelinated nerve fibers. Demarcates the juxtaparanodal region of the axo-glial junction.
More Information
SKU CSB-EP887030HU-100
Manufacturer Cusabio
Manufacturer SKU CSB-EP887030HU-100
Package Unit 100 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download