Recombinant Mouse Cell surface glycoprotein CD200 receptor 1 (Cd200r1), partial, Biotinylated

Recombinant Mouse Cell surface glycoprotein CD200 receptor 1 (Cd200r1), partial, Biotinylated
SKU
CSB-EP863669MO-B-1
Packaging Unit
1 mg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Cardiovascular

Uniprot: Q9ES57

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 73.5 kDa

Gene Names: Cd200r1

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 26-238aa

Protein Length: Partial

Target Protein Sequence: TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Endotoxin: Not test.

Relevance: Inhibitory receptor for the CD200/OX2 cell surface glycoprotein. Limits inflammation by inhibiting the expression of pro-inflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli.
More Information
SKU CSB-EP863669MO-B-1
Manufacturer Cusabio
Manufacturer SKU CSB-EP863669MO-B-1
Package Unit 1 mg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download