Research Areas: Others
Uniprot: Q9DLD6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: C-terminal 6xHis-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 49.2 kDa
Gene Names: P
Organism: Newcastle disease virus (strain Chicken/United States/B1/48) (NDV)
Source: E.coli
Expression Region: 1-395aa
Protein Length: Full Length
Target Protein Sequence: MATFTDAEIDELFETSGTVIDNIITAQGKPAETVGRSAIPQGKTKVLSAAWEKHGSIQPPASQDNPDRQDRSDKQPSTPEQTTPHDSPPATSADQPPTQATDEAVDTQLRTGASNSLLLMLDKLSNKSSNAKKGPWSSPQEGNHQRPTQQQGSQPSRGNSQERPQNQVKAAPGNQGTDVNTAYHGQWEESQLSAGATPHGLRSKQSQNNTPVSADHFHPPVDFVQAMMSIMEGISQRVSKVAYQVDLVFKQTSSIPMMGSEIQQLKTFVAVMEANLGMMKILDPGCANISSLSDLRAVARSHPVLVSGPGDPSPYVIQGGEMALNKLSQPVPHPSELIKPATACGPDIGVERDTVRALIMSRPMHPSSSAKLLSKLDAAGSIEEIRKIKRLALNG
Endotoxin: Not test.
Relevance: Essential component of the RNA polymerase transcription and replication complex. Binds the viral ribonucleocapsid and positions the L polymerase on the template. ; Acts as a chaperone for newly synthesized free N protein, so-called N(0). Stabilizes the L protein upon binding it.
English
Deutsch
