Anti-CUL9 Magnetic Beads

Uniprot: Q8IWT3

Gene Name: CUL9

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: SSSTSRNHSCTPDPEEESKSEASFSEEETESLKAKAEAPKTEAEPTKTRTETPMAQSDSQLFNQLLVTEGMTLPTEMKEAASEMARALRGPGPRSSLDQHVAAVVATVQISSLDTNLQLSGLSALSQAVE

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Pig - 86%, Cynomolgus monkey - 95%

Alternative gene names: H7AP1; KIAA0708; PARC

Alternative protein names: Cullin-9; CUL-9; UbcH7-associated protein 1; p53-associated parkin-like cytoplasmic protein

Protein name: Cullin 9

Product panel: E3 Ligase

Antigen Species: Human

Target Name: CUL9

IP Dilution: 1:5

Antigen ID: PP-8623

Bead diameter: 0.5 μm

• SKU: ASBMB-077-5
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: MB-077-5
• Package Unit: 5 ml
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine)
• Clonality: Monoclonal
• Application: Immunoprecipitation
• Isotype: IgG1
• Human Gene ID: 23113
• Host: Mouse