Anti-TRIM43B Magnetic Beads

Uniprot: A6NCK2

Gene Name: TRIM43B

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: KMFCDMDKSLLCLLCSNSQEHGAHKHYPIEEAAEEDREKLLKQMRILWKKIQENQRNLYEERRTAFLLRGDVVLRAQMIRNEYRKLHPVLHKEEKQHLERLNKEYQEIFQQLQRSWVKMDQKSKHLKEMYQELMEMCHKP

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 39%, Rat - 32%, Pig - 49%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Tripartite motif-containing protein 43B

Protein name: Tripartite motif containing 43B

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRIM43B

IP Dilution: 1:5

Antigen ID: PP-9978

Bead diameter: 0.5 μm

• SKU: ASBMB-060-5
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: MB-060-5
• Package Unit: 5 ml
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunoprecipitation
• Isotype: IgG2a
• Human Gene ID: 653192
• Host: Mouse