Anti-UHRF2 Magnetic Beads

Uniprot: Q96PU4

Gene Name: UHRF2

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: PSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKHKSKENTNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRARTILKWNELNVGDVVMVNYNVESPGQRGFWFDAEITTLKTISRTKKELRVKIFLGGSEGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVAYHIYCLNPPLDKVPEEEYWYCP

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 88%, Rat - 42%, Pig - 84%, Cynomolgus monkey - 98%

Alternative gene names: NIRF; RNF107

Alternative protein names: E3 ubiquitin-protein ligase UHRF2; Np95/ICBP90-like RING finger protein; Np95-like RING finger protein; Nuclear protein 97; Nuclear zinc finger protein Np97; RING finger protein 107; RING-type E3 ubiquitin transferase UHRF2; Ubiquitin-like PHD and RING finger domain-containing protein 2; Ubiquitin-like-containing PHD and RING finger domains protein 2

Protein name: Ubiquitin like with PHD and ring finger domains 2

Product panel: E3 Ligase

Antigen Species: Human

Target Name: UHRF2

IP Dilution: 1:5

Antigen ID: PP-5335

Bead diameter: 0.5 μm

• SKU: ASBMB-059-5
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: MB-059-5
• Package Unit: 5 ml
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunoprecipitation
• Isotype: IgG1
• Human Gene ID: 115426
• Host: Mouse