Anti-DTX3L Magnetic Beads

Uniprot: Q8TDB6

Gene Name: DTX3L

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: RVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSERAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAETPSGDMHQHE

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 51%, Pig - 57%, Cynomolgus monkey - 88%

Alternative gene names: BBAP

Alternative protein names: E3 ubiquitin-protein ligase DTX3L; B-lymphoma- and BAL-associated protein; Protein deltex-3-like; RING-type E3 ubiquitin transferase DTX3L; Rhysin-2; Rhysin2

Protein name: Deltex E3 ubiquitin ligase 3L

Product panel: E3 Ligase

Antigen Species: Human

Target Name: DTX3L

IP Dilution: 1:5

Antigen ID: PP-8044

Bead diameter: 0.5 μm

• SKU: ASBMB-052-1
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: MB-052-1
• Package Unit: 1 ml
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunoprecipitation
• Isotype: IgG1
• Human Gene ID: 151636
• Host: Mouse