Anti-PPIL2 Magnetic Beads

Uniprot: Q13356

Gene Name: PPIL2

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: YVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGS

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 49%, Pig - 90%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: RING-type E3 ubiquitin-protein ligase PPIL2; CYC4; Cyclophilin-60; Cyclophilin-like protein Cyp-60; Cyp60; hCyP-60; Probable inactive peptidyl-prolyl cis-trans isomerase-like 2; PPIase; Rotamase PPIL2

Protein name: Peptidylprolyl isomerase like 2

Product panel: E3 Ligase

Antigen Species: Human

Target Name: PPIL2

IP Dilution: 1:5

Antigen ID: PP-5924

Bead diameter: 0.5 μm

• SKU: ASBMB-040-1
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: MB-040-1
• Package Unit: 1 ml
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunoprecipitation
• Isotype: IgG1
• Human Gene ID: 23759
• Host: Mouse