Anti-RMND5A Magnetic Beads

Uniprot: Q9H871

Gene Name: RMND5A

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: ELIDYTGGLKHEILQSHGQDAELSGTLSLVLTQCCKRIKDTVQKLASDHKDIHSSVSRVGKAIDKNFDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAEELCQESGLSVDPSQ

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: E3 ubiquitin-protein transferase RMND5A; P44CTLH; Protein RMD5 homolog A

Protein name: Required for meiotic nuclear division 5 homolog A

Product panel: E3 Ligase

Antigen Species: Human

Target Name: RMND5A

IP Dilution: 1:5

Antigen ID: PP-8291

Bead diameter: 0.5 μm

• SKU: ASBMB-028-5
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: MB-028-5
• Package Unit: 5 ml
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunoprecipitation
• Isotype: IgG1
• Human Gene ID: 64795
• Host: Mouse