Anti-TANK Magnetic Beads

Uniprot: Q92844

Gene Name: TANK

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: KAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPRK

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Pig - 88%, Cynomolgus monkey - 95%

Alternative gene names: ITRAF; TRAF2

Alternative protein names: TRAF family member-associated NF-kappa-B activator; TRAF-interacting protein; I-TRAF

Protein name: TRAF family member associated NFKB activator

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TANK

IP Dilution: 1:5

Antigen ID: PP-939

Bead diameter: 0.5 μm

• SKU: ASBMB-025-1
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: MB-025-1
• Package Unit: 1 ml
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunoprecipitation
• Isotype: IgG1
• Human Gene ID: 10010
• Host: Mouse