Anti-TRAF3 Magnetic Beads

Uniprot: Q13114

Gene Name: TRAF3

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: HEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLA

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: CAP-1; CRAF1; TRAFAMN

Alternative protein names: TNF receptor-associated factor 3; CD40 receptor-associated factor 1; CRAF1; CD40-binding protein; CD40BP; LMP1-associated protein 1; LAP1; RING-type E3 ubiquitin transferase TRAF3

Protein name: TNF receptor associated factor 3

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRAF3

IP Dilution: 1:5

Antigen ID: PP-602

Bead diameter: 0.5 μm

• SKU: ASBMB-045-5
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: MB-045-5
• Package Unit: 5 ml
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine)
• Clonality: Monoclonal
• Application: Immunoprecipitation
• Isotype: IgG1
• Human Gene ID: 7187
• Host: Mouse