Anti-TRIM34 Magnetic Beads

Uniprot: Q9BYJ4

Gene Name: TRIM34

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: GEKLLLFCKEDRKVICWLCERSQEHRGHHTVLTEEVFKECQEKLQAVLKRLKKEEEEAEKLEADIREEKTSWKYQVQTERQRIQTEFDQLRSILNNEEQRELQRLEEEEKKTLDKFAEAE

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Rat - 38%, Pig - 67%, Cynomolgus monkey - 96%

Alternative gene names: IFP1; RNF21

Alternative protein names: E3 ubiquitin-protein ligase TRIM34; Interferon-responsive finger protein 1; RING finger protein 21

Protein name: Tripartite motif containing 34

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRIM34

IP Dilution: 1:5

Antigen ID: PP-7411

Bead diameter: 0.5 μm

• SKU: ASBMB-039-5
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: MB-039-5
• Package Unit: 5 ml
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunoprecipitation
• Isotype: IgG2a
• Human Gene ID: 53840
• Host: Mouse