Anti-TRIM59 Magnetic Beads

Uniprot: Q8IWR1

Gene Name: TRIM59

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: IDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKF

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 83%, Pig - 88%, Cynomolgus monkey - 94%

Alternative gene names: RNF104; TRIM57; TSBF1

Alternative protein names: Tripartite motif-containing protein 59; RING finger protein 104; Tumor suppressor TSBF-1

Protein name: Tripartite motif containing 59

Product panel: E3 Ligase

Antigen Species: Human

Target Name: TRIM59

IP Dilution: 1:5

Antigen ID: PP-2433

Bead diameter: 0.5 μm

• SKU: ASBMB-031-5
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: MB-031-5
• Package Unit: 5 ml
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunoprecipitation
• Isotype: IgG1
• Human Gene ID: 286827
• Host: Mouse