Anti-WWP2 Magnetic Beads

Uniprot: O00308

Gene Name: WWP2

Purity: ≥85%

Formulation: Supplied as solution in phosphate buffered saline containing 0.01% BSA and 0.02% sodium azide

Core Sequence: TAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYE

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Rat - 36%, Pig - 88%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: NEDD4-like E3 ubiquitin-protein ligase WWP2; Atrophin-1-interacting protein 2; AIP2; HECT-type E3 ubiquitin transferase WWP2; WW domain-containing protein 2

Protein name: WW domain containing E3 ubiquitin protein ligase 2

Product panel: E3 Ligase

Antigen Species: Human

Target Name: WWP2

IP Dilution: 1:5

Antigen ID: PP-1301

Bead diameter: 0.5 μm

• SKU: ASBMB-006-1
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: MB-006-1
• Package Unit: 1 ml
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunoprecipitation
• Isotype: IgG2a
• Human Gene ID: 11060
• Host: Mouse