Plasma Diluent for Histamine ELISA

Description of Target: Sequence (One Letter Code): YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH

Sequence: {TYR} {ARG} {GLN} {SER} {MET} {ASN} {ASN} {PHE} {GLN} {GLY} {LEU} {ARG} {SER} {PHE} {GLY} {CYS} {ARG} {PHE} {GLY} {THR} {CYS} {THR} {VAL} {GLN} {LYS} {LEU} {ALA} {HIS} {GLN} {ILE} {TYR} {GLN} {PHE} {THR} {ASP} {LYS} {ASP} {LYS} {ASP} {ASN} {VAL} {ALA} {PRO} {ARG} {SER} {LYS} {ILE} {SER} {PRO} {GLN} {GLY} {TYR}-NH2 C Terminal: NH2

Formula: C264H406N80O77S3 Chemical Bridge: Disulfide bridge: Cys16-Cys21

Solubility: Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. Adrenomedullin (1-52) is a potent hypotensive peptide hormone with structural similarity to calcitonin gene-related peptide. Adrenomedullin (1-52) has vasodilatory properties.

N/A [1] Kaufmann,C. and Brown,M.R., et al.
Adipokinetic hormones in the African malaria mosquito, Anopheles gambiae: Identification and expression of genes for two peptides and a putative receptor
[2] Kaufmann,C. and Brown,M.R., et al.
Direct Submission
[3] Kaufmann C., Brown M.R.
Adipokinetic hormones in the African malaria mosquito, Anopheles gambiae: Identification and expression of genes for two peptides and a putative receptor.

Tag: Q27J46

• SKU: AVIGWB-391F61-10ML
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: GWB-391F61-10ML
• Green Labware: No
• Package Unit: 10 mL
• Quantity Unit: STK