RFPL3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFPL3

Key Reference: Rauch,T., (2006) Cancer Res. 66 (16), 7939-7947

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: VYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ret finger protein-like 3

Protein Size: 317

Purification: Affinity Purified

• SKU: AVIARP57945_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57945_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10738
• Host: Rabbit