RHOB Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: RHOB mediates apoptosis in neoplastically transformed cells after DNA damage.RHOB is not essential for development but affects cell adhesion and growth factor signaling in transformed cells.RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. RHOB is involved in intracellular protein trafficking of a number of proteins.RHOB targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes.RHOB is also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHOB

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho-related GTP-binding protein RhoB

Protein Size: 196

Purification: Affinity Purified

• SKU: AVIARP54702_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54702_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 388
• Host: Rabbit