RIC8A Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RIC8A is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins.RIC8A is able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP.RIC8A is involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. RIC8A also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RIC8A

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Synembryn-A

Protein Size: 537

Purification: Affinity Purified

• SKU: AVIARP57567_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57567_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 60626
• Host: Rabbit