RIC8A Antibody - N-terminal region : HRP

RIC8A Antibody - N-terminal region : HRP
SKU
AVIARP57567_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RIC8A is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins.RIC8A is able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP.RIC8A is involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. RIC8A also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RIC8A

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Synembryn-A

Protein Size: 537

Purification: Affinity Purified
More Information
SKU AVIARP57567_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57567_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 60626
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×