RIPK5 Antibody - middle region : Biotin

RIPK5 Antibody - middle region : Biotin
SKU
AVIARP55938_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIPK5

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dual serine/threonine and tyrosine protein kinase

Protein Size: 884

Purification: Affinity Purified
More Information
SKU AVIARP55938_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55938_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25778
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×