RIPK5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIPK5

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dual serine/threonine and tyrosine protein kinase

Protein Size: 884

Purification: Affinity Purified

• SKU: AVIARP55938_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55938_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 25778
• Host: Rabbit