RNF5 Antibody - C-terminal region : FITC

RNF5 Antibody - C-terminal region : FITC
SKU
AVIARP58180_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF5

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: FPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 180

Purification: Affinity purified
More Information
SKU AVIARP58180_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58180_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6048
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×