RNPEPL1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNPEPL1

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arginyl aminopeptidase-like 1

Protein Size: 494

Purification: Affinity Purified

• SKU: AVIARP57162_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57162_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57140
• Host: Rabbit