Romo1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Romo1 induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. It may play a role in inducing oxidative DNA damage and replicative senescence.

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: PVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calmodulin-regulated spectrin-associated protein 1

Protein Size: 79

Purification: Affinity Purified

• SKU: AVIARP58431_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58431_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 67067
• Host: Rabbit
• Conjugate: Conjugated, HRP