RP11-217H1.1 Antibody - N-terminal region : Biotin

RP11-217H1.1 Antibody - N-terminal region : Biotin
SKU
AVIARP58725_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-217H1.1

Key Reference: Shibatani,T., (2005) Biochemistry 44 (16), 5982-5992

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ56344, highly similar to Implantation-associated protein EMBL BAG58019.1

Protein Size: 367

Purification: Affinity Purified
More Information
SKU AVIARP58725_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58725_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 84061
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×