RP11-298P3.3 Antibody - N-terminal region : Biotin

RP11-298P3.3 Antibody - N-terminal region : Biotin
SKU
AVIARP55406_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-298P3.3

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NEDD4-binding protein 2-like 2

Protein Size: 752

Purification: Affinity Purified
More Information
SKU AVIARP55406_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55406_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10443
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×