RP11-529I10.4 Antibody - N-terminal region : HRP

RP11-529I10.4 Antibody - N-terminal region : HRP
SKU
AVIARP55256_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-529I10.4

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein DPCD

Protein Size: 203

Purification: Affinity Purified
More Information
SKU AVIARP55256_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55256_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25911
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×