RPA1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair. RPA1 binds and subsequently stabilizes single-stranded DNA intermediates and thus prevents complementary DNA from reannealing

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPA1

Key Reference: Tomida,J., (2008) J. Biol. Chem. 283 (14), 9071-9079

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Replication protein A 70 kDa DNA-binding subunit

Protein Size: 616

Purification: Affinity Purified

• SKU: AVIARP56525_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56525_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6117
• Host: Rabbit