RPA4 Antibody - middle region : HRP

RPA4 Antibody - middle region : HRP
SKU
AVIARP54941_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. This gene encodes the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1448 BC069824.1 1-1448

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPA4

Key Reference: Wu,X., Biochem. J. 391 (PT 3), 473-480 (2005)

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Replication protein A 30 kDa subunit

Protein Size: 261

Purification: Affinity Purified
More Information
SKU AVIARP54941_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54941_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29935
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×