RPIA Antibody - N-terminal region : HRP

RPIA Antibody - N-terminal region : HRP
SKU
AVIARP55438_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPIA

Key Reference: Huck,J.H., (2004) Am. J. Hum. Genet. 74 (4), 745-751

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ribose-5-phosphate isomerase

Protein Size: 311

Purification: Affinity Purified
More Information
SKU AVIARP55438_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55438_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22934
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×