Rpl17 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rpl17 is a component of the 60S subunit of the ribosome, the organelles that catalyze protein synthesis; member of the L22P family of ribosomal proteins; induced under amino acid deprivation of cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rpl17

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: APKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKIS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 60S ribosomal protein L17

Protein Size: 184

Purification: Affinity Purified

• SKU: AVIARP56130_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56130_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 291434
• Host: Rabbit