RPL18 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18E family of ribosomal proteins that is a component of the 60S subunit. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL18

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: QLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 188

Purification: Affinity Purified

• SKU: AVIARP56128_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56128_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6141
• Host: Rabbit