Rpl5 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Rpl5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 60S ribosomal protein L5

Protein Size: 297

Purification: Affinity Purified

• SKU: AVIARP56126_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56126_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 19983
• Host: Rabbit