RPL5 Antibody - N-terminal region : Biotin

RPL5 Antibody - N-terminal region : Biotin
SKU
AVIARP56125_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of four RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18P family of ribosomal proteins and component of the 60S subunit. The encoded protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The encoded protein may also function to inhibit tumorigenesis through the activation of downstream tumor suppressors and the downregulation of oncoprotein expression. Mutations in this gene have been identified in patients with Diamond-Blackfan Anemia (DBA). This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPL5

Key Reference: Sun,X.X., (2007) J. Biol. Chem. 282 (11), 8052-8059

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 60S ribosomal protein L5

Protein Size: 297

Purification: Affinity Purified
More Information
SKU AVIARP56125_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56125_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6125
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×