RPS21 Antibody - middle region : Biotin

RPS21 Antibody - middle region : Biotin
SKU
AVIARP56209_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPS21

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: NVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 40S ribosomal protein S21

Protein Size: 83

Purification: Affinity Purified
More Information
SKU AVIARP56209_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56209_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6227
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×