RPS27L Antibody - N-terminal region : HRP

RPS27L Antibody - N-terminal region : HRP
SKU
AVIARP56775_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS27L

Key Reference: Goto,Y., (2006) FEBS Lett. 580 (7), 1833-1838

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 40S ribosomal protein S27-like

Protein Size: 84

Purification: Affinity Purified
More Information
SKU AVIARP56775_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56775_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51065
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×