Rpsa Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rpsa is required for the assembly and/or stability of the 40S ribosomal subunit. It is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. It slso functions as a cell surface receptor for laminin. It plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. It may play a role in cell fate determination and tissue morphogenesis. It also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. It enables malignant tumor cells to penetrate laminin tissue and vessel barriers and activates precursor thymic anti-OFA/iLRP specific cytotoxic T cell. It may induce CD8 T-suppressor cells secreting IL-10.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: QMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 40S ribosomal protein SA

Protein Size: 295

Purification: Affinity Purified

• SKU: AVIARP54682_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54682_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 16785
• Host: Rabbit