RRAD Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents. RRAD regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane. RRAD inhibits cardiac hy

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RRAD

Key Reference: Chang,L., (2007) Circulation 116 (25), 2976-2983

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GTP-binding protein RAD

Protein Size: 308

Purification: Affinity Purified

• SKU: AVIARP56567_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56567_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6236
• Host: Rabbit