RRAGC Antibody - N-terminal region : Biotin

RRAGC Antibody - N-terminal region : Biotin
SKU
AVIARP57617_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the GTR/RAG GTP-binding protein family. The encoded protein is a monomeric guanine nucleotide-binding protein which forms a heterodimer with RRAGA and RRAGB and is primarily localized to the cytoplasm. The encoded protein promotes intracellular localization of the mTOR complex. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RRAGC

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related GTP-binding protein C

Protein Size: 399

Purification: Affinity Purified
More Information
SKU AVIARP57617_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57617_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64121
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×