Rras Antibody - C-terminal region : HRP

Rras Antibody - C-terminal region : HRP
SKU
AVIARP56712_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rras regulates the organization of the actin cytoskeleton

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rras

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: ASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein R-Ras

Protein Size: 218

Purification: Affinity Purified
More Information
SKU AVIARP56712_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56712_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 361568
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×