RRAS2 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRAS2

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: EASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein R-Ras2

Protein Size: 204

Purification: Affinity Purified

• SKU: AVIARP54549_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54549_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22800
• Host: Rabbit