RSAD1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RSAD1 may be involved in porphyrin cofactor biosynthesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RSAD1

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: NWTYWQCGQYLGVGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Radical S-adenosyl methionine domain-containing protein 1, mitochondrial

Protein Size: 442

Purification: Affinity Purified

• SKU: AVIARP57212_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57212_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55316
• Host: Rabbit