RSPH10B Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RSPH10B

Key Reference: Yang,P., J. Cell. Sci. 119 (PT 6), 1165-1174 (2006)

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Radial spoke head 10 homolog B2

Protein Size: 870

Purification: Affinity Purified

• SKU: AVIARP56027_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56027_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 222967
• Host: Rabbit