RSPH14 Antibody - N-terminal region : Biotin

RSPH14 Antibody - N-terminal region : Biotin
SKU
AVIARP55055_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RTDR1

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: radial spoke head 14 homolog

Protein Size: 348

Purification: Affinity Purified
More Information
SKU AVIARP55055_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55055_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27156
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×