RSPH14 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RTDR1

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: radial spoke head 14 homolog

Protein Size: 348

Purification: Affinity Purified

• SKU: AVIARP55055_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55055_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27156
• Host: Rabbit