S100A6 Antibody - middle region : Biotin

S100A6 Antibody - middle region : Biotin
SKU
AVIARP56747_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human S10A6

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: ELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protein S100-A6

Protein Size: 90

Purification: Affinity Purified
More Information
SKU AVIARP56747_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56747_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6277
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×