S100A9 Antibody - N-terminal region : FITC

S100A9 Antibody - N-terminal region : FITC
SKU
AVIARP56533_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human S100A9

Key Reference: Ghavami,S., (2008) Biochim. Biophys. Acta 1783 (2), 297-311

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein S100-A9

Protein Size: 114

Purification: Affinity Purified
More Information
SKU AVIARP56533_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56533_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 6280
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×