S100PBP Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human S100PBP

Key Reference: Deng,H., (2008) Am. J. Clin. Pathol. 129 (1), 81-88

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: S100P-binding protein Ensembl ENSP00000381296

Protein Size: 341

Purification: Affinity Purified

• SKU: AVIARP56213_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56213_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64766
• Host: Rabbit