SAMD8 Antibody - middle region : Biotin

SAMD8 Antibody - middle region : Biotin
SKU
AVIARP58524_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAMD8

Key Reference: Jin,Y.J., (2005) Science 307 (5715), 1621-1625

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sphingomyelin synthase-related protein 1

Protein Size: 326

Purification: Affinity Purified
More Information
SKU AVIARP58524_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58524_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 142891
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×