SAR1A Antibody - middle region : Biotin

SAR1A Antibody - middle region : Biotin
SKU
AVIARP56244_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse SAR1A

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: AISEERLREMFGLYGQTTGKGSVSLKELNARPLGVFMCSVLKRQGYGEGF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding protein SAR1a

Protein Size: 198

Purification: Affinity Purified
More Information
SKU AVIARP56244_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56244_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56681
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×